| Class b: All beta proteins [48724] (104 folds) |
| Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily) |
Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins) |
| Protein Archaeal homoheptameric Sm protein [63758] (3 species) |
| Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [63760] (1 PDB entry) |
| Domain d1i8fb_: 1i8f B: [61960] |
PDB Entry: 1i8f (more details), 1.75 Å
SCOP Domain Sequences for d1i8fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i8fb_ b.38.1.1 (B:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum}
fatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmvv
rgenvlfispvp
Timeline for d1i8fb_: