Lineage for d1i8fb_ (1i8f B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58846Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily)
  4. 58847Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) (S)
  5. 58848Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)
  6. 58849Protein Archaeal homoheptameric Sm protein [63758] (3 species)
  7. 58901Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [63760] (1 PDB entry)
  8. 58903Domain d1i8fb_: 1i8f B: [61960]

Details for d1i8fb_

PDB Entry: 1i8f (more details), 1.75 Å

PDB Description: the crystal structure of a heptameric archaeal sm protein: implications for the eukaryotic snrnp core

SCOP Domain Sequences for d1i8fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i8fb_ b.38.1.1 (B:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum}
fatlgatlqdsigkqvlvklrdsheirgilrsfdqhvnllledaeeiidgnvykrgtmvv
rgenvlfispvp

SCOP Domain Coordinates for d1i8fb_:

Click to download the PDB-style file with coordinates for d1i8fb_.
(The format of our PDB-style files is described here.)

Timeline for d1i8fb_: