SCOP 1.63: Domain d1i84t_: 1i84 T:

Lineage for d1i84t_ (1i84 T:)

1. Root: SCOP 1.63

2. Class i: Low resolution protein structures [58117] (18 folds)

3. Fold i.15: Muscle protein complexes [64616] (1 superfamily)

4. Superfamily i.15.1: Muscle protein complexes [64617] (1 family)

5. Family i.15.1.1: Muscle protein complexes [64618] (2 proteins)

6. Protein Heavy meromyosin subfragment [64619] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [64620] (1 PDB entry)

8. Domain d1i84t_: 1i84 T: [61941]

Details for d1i84t_

PDB Entry: 1i84

PDB Description: cryo-em structure of the heavy meromyosin subfragment of chicken gizzard smooth muscle myosin with regulatory light chain in the dephosphorylated state. only c alphas provided for regulatory light chain. only backbone atoms provided for s2 fragment.

SCOP Domain Sequences for d1i84t_:

Sequence; same for both SEQRES and ATOM records:

>d1i84t_ i.15.1.1 (T:) Heavy meromyosin subfragment {Chicken (Gallus gallus)}
fseeqtaefkeafqlfdrtgdgkilysqcgdvmralgqnptnaevmkvlgnpksdemnlk
tlkfeqflpmmqtiaknkdqgcfedyveglrvfdkegngtvmgaeirhvlvtlgekmtee
eveqlvaghedsngcinyeelvrmvlsg

Timeline for d1i84t_:

• d1i84t_ first appeared in SCOP 1.57
  
• d1i84t_ appears in SCOP 1.61
  
• d1i84t_ appears in SCOP 1.65
  
• d1i84t_ appears in the current release, SCOPe 2.08