Lineage for d1i81g_ (1i81 G:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948630Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 948631Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 948632Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 948633Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 948679Species Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
    MTH649, smap1
  8. 948714Domain d1i81g_: 1i81 G: [61936]

Details for d1i81g_

PDB Entry: 1i81 (more details), 2 Å

PDB Description: crystal structure of a heptameric lsm protein from methanobacterium thermoautotrophicum
PDB Compounds: (G:) putative snrnp sm-like protein

SCOPe Domain Sequences for d1i81g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i81g_ b.38.1.1 (G:) Archaeal homoheptameric Sm protein {Methanobacterium thermoautotrophicum [TaxId: 145262]}
vnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgt
vlirgdnivyisp

SCOPe Domain Coordinates for d1i81g_:

Click to download the PDB-style file with coordinates for d1i81g_.
(The format of our PDB-style files is described here.)

Timeline for d1i81g_: