SCOP 1.73: Domain d1i81d_: 1i81 D:

Lineage for d1i81d_ (1i81 D:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.38: Sm-like fold [50181] (3 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (5 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
   forms homo and heteroheptameric ring structures

6. Protein Archaeal homoheptameric Sm protein [63758] (6 species)

7. Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [63759] (5 PDB entries)
   MTH649, smap1

8. Domain d1i81d_: 1i81 D: [61933]

Details for d1i81d_

PDB Entry: 1i81, 2 Å

PDB Description: crystal structure of a heptameric lsm protein from methanobacterium thermoautotrophicum

PDB Compounds: (D:) putative snrnp sm-like protein

SCOP Domain Sequences for d1i81d_:

Sequence; same for both SEQRES and ATOM records:

>d1i81d_ b.38.1.1 (D:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
vnvqrpldalgnslnspviiklkgdrefrgvlksfdlhmnlvlndaeeledgevtrrlgt
vlirgdnivyisp

Timeline for d1i81d_:

• d1i81d_ first appeared in SCOP 1.57
  
• d1i81d_ appears in SCOP 1.71
  
• d1i81d_ appears in SCOP 1.75
  
• d1i81d_ appears in the current release, SCOPe 2.08