Lineage for d1i80a_ (1i80 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 996838Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 996948Protein Purine nucleoside phosphorylase, PNP [53169] (10 species)
  7. 997096Species Mycobacterium tuberculosis [TaxId:1773] [64098] (3 PDB entries)
  8. 997103Domain d1i80a_: 1i80 A: [61927]
    complexed with 9hx, imr, po4

Details for d1i80a_

PDB Entry: 1i80 (more details), 2 Å

PDB Description: crystal structure of m. tuberculosis pnp in complex with iminoribitol, 9-deazahypoxanthine and phosphate ion
PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d1i80a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i80a_ c.56.2.1 (A:) Purine nucleoside phosphorylase, PNP {Mycobacterium tuberculosis [TaxId: 1773]}
dprpdpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvp
ptaaghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaag
glradlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyag
lpgphyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgepls
haevlaagaasatrmgalladviarf

SCOPe Domain Coordinates for d1i80a_:

Click to download the PDB-style file with coordinates for d1i80a_.
(The format of our PDB-style files is described here.)

Timeline for d1i80a_: