Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (9 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (11 proteins) contains a catalytic Cys-His-Glu triad |
Protein Anthranilate synthase GAT subunit, TrpG [52323] (3 species) |
Species Serratia marcescens [TaxId:615] [63970] (2 PDB entries) |
Domain d1i7qd_: 1i7q D: [61904] Other proteins in same PDB: d1i7qa_, d1i7qc_ complexed with bez, ilg, mg, pyr |
PDB Entry: 1i7q (more details), 1.95 Å
SCOP Domain Sequences for d1i7qd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i7qd_ c.23.16.1 (D:) Anthranilate synthase GAT subunit, TrpG {Serratia marcescens [TaxId: 615]} adillldnvdsftynlvdqlrasghqvviyrnqigaeviierlqhmeqpvlmlspgpgtp seagcmpellqrlrgqlpiigiclghqaiveayggqvgqageilhgkasaiahdgegmfa gmanplpvaryhslvgsnipadltvnarfgemvmavrddrrrvcgfqfhpesiltthgar lleqtlawalak
Timeline for d1i7qd_: