SCOPe 2.04: Domain d1i7qc_: 1i7q C:

Lineage for d1i7qc_ (1i7q C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.161: ADC synthase [56321] (1 superfamily)
   duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets

4. Superfamily d.161.1: ADC synthase [56322] (2 families)
   the active site is formed by additional structures inserted into the core structure

5. Family d.161.1.1: ADC synthase [56323] (6 proteins)

6. Protein Anthranilate synthase aminodeoxyisochorismate synthase/lyase subunit, TrpE [56324] (3 species)

7. Species Serratia marcescens [TaxId:615] [64443] (2 PDB entries)

8. Domain d1i7qc_: 1i7q C: [61903]
   Other proteins in same PDB: d1i7qb_, d1i7qd_
   complexed with bez, glu, mg, pyr

Details for d1i7qc_

PDB Entry: 1i7q, 1.95 Å

PDB Description: anthranilate synthase from s. marcescens

PDB Compounds: (C:) anthranilate synthase

SCOPe Domain Sequences for d1i7qc_:

Sequence; same for both SEQRES and ATOM records:

>d1i7qc_ d.161.1.1 (C:) Anthranilate synthase aminodeoxyisochorismate synthase/lyase subunit, TrpE {Serratia marcescens [TaxId: 615]}
tkpqltllkvqasyrgdpttlfhqlcgarpatlllesaeindkqnlqsllvidsalrita
lghtvsvqaltangpallplldealppevrnqarpngreltfpaidavqdedarlrslsv
fdalrtiltlvdspadereavmlgglfaydlvagfenlpalrqdqrcpdfcfylaetllv
ldhqrgsarlqasvfseqaseaqrlqhrleqlqaelqqppqpiphqklenmqlscnqsde
eygavvselqeairqgeifqvvpsrrfslpcpaplgpyqtlkdnnpspymffmqdddftl
fgaspesalkydagnrqieiypiagtrprgrradgsldldldsrielemrtdhkelaehl
mlvdlarndlaricqagsryvadltkvdrysfvmhlvsrvvgtlradldvlhayqacmnm
gtlsgapkvramqliaalrstrrgsyggrvgyftavrnldtcivirsayvedghrtvqag
agvvqdsipereadetrnkaravlraiatahhakevf

Timeline for d1i7qc_:

• d1i7qc_ first appeared in SCOP 1.57
  
• d1i7qc_ appears in SCOPe 2.03
  
• d1i7qc_ appears in SCOPe 2.05
  
• d1i7qc_ appears in the current release, SCOPe 2.08