Lineage for d1i75a4 (1i75 A:1-406)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1143364Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1145288Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1145289Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1145512Protein Cyclodextrin glycosyltransferase [51452] (5 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 1145554Species Bacillus sp. 1011, alkaliphilic [TaxId:1410] [51456] (8 PDB entries)
    Uniprot P05618
  8. 1145561Domain d1i75a4: 1i75 A:1-406 [61872]
    Other proteins in same PDB: d1i75a1, d1i75a2, d1i75a3, d1i75b1, d1i75b2, d1i75b3
    complexed with ca, noj

Details for d1i75a4

PDB Entry: 1i75 (more details), 2 Å

PDB Description: crystal structure of cyclodextrin glucanotransferase from alkalophilic bacillus sp.#1011 complexed with 1-deoxynojirimycin
PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d1i75a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i75a4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus sp. 1011, alkaliphilic [TaxId: 1410]}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay

SCOPe Domain Coordinates for d1i75a4:

Click to download the PDB-style file with coordinates for d1i75a4.
(The format of our PDB-style files is described here.)

Timeline for d1i75a4: