Lineage for d1i6vd_ (1i6v D:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574346Family e.29.1.2: RNA-polymerase beta-prime [64490] (4 proteins)
  6. 2574381Protein RNA-polymerase beta-prime [64493] (2 species)
  7. 2574382Species Thermus aquaticus [TaxId:271] [64494] (4 PDB entries)
  8. 2574385Domain d1i6vd_: 1i6v D: [61857]
    Other proteins in same PDB: d1i6va1, d1i6va2, d1i6vb1, d1i6vb2, d1i6vc_, d1i6ve_
    protein/DNA complex; protein/RNA complex; complexed with mg, rfp, zn

Details for d1i6vd_

PDB Entry: 1i6v (more details), 3.3 Å

PDB Description: thermus aquaticus core rna polymerase-rifampicin complex
PDB Compounds: (D:) DNA-directed RNA polymerase

SCOPe Domain Sequences for d1i6vd_:

Sequence, based on SEQRES records: (download)

>d1i6vd_ e.29.1.2 (D:) RNA-polymerase beta-prime {Thermus aquaticus [TaxId: 271]}
kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
ykrqrfeakvcercavevtrsivrryrmahielatpaahiwfvkdvpskiatlldlsate
leqvlyfnkyivldpkaavldavpvekrqlltdxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxidarmgaeaiqellkeldleklerelleemkhpsrarrakarkrlevvraf
ldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlndlyrrlinrnnrlkkllaqga
peiiirnekrmlqeavdavidngrrgspvtnpgserplrsltdilsgkqgrfrqnllgkr
vdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkmeekafapnvkaarrmlerqrd
ikdevwdaleevihgkvvllnraptlhrlgiqafqpvlvegqsiqlhplvceafnadfdg
dqmavhvplssfaqaeariqmlsahnllspasgeplakpsrdiilglyyitqvrkekkga
gmafatpeealaayergevalnapivvagretsvgrlkfvfanpdeallavahglldlqd
tvttrylgrrletspgrilfarivgeavgdekvaqeliqmdvpqeknslkdlvyqaflrl
gmektarlldalkyygftlsttsgitigiddavipeekqryleeadrklrqieqayemgf
ltdrerydqviqlwtettekvtqavfnnfeenypfnplyvmaqsgargnpqqirqlcgmr
glmqkpsgetfevpvrssfregltvleyfisshgarkggadtalrtadsgyltrklvdva
heivvreadcgttnyisvplfqmdevtrtlrlrkrsdiesglygrvlarevealgrrlee
grylsledvhflikaaeagevrevpvrspltcqtrygvcqkcygydlsmarpvsigeavg
vvaaesigepgtqltmrtfhtggvavgtditqglprvielfearrpkakaviseidgvvr
ieegedrlsvfvesegfskeyklpkdarllvkdgdyveagqpltrgaidphqlleakgpe
averylvdeiqkvyraqgvklhdkhieivvrqmlkyvevtdpgdsrllegqvlekwdvea
lnerliaegkvpvawkpllmgvtksalstkswlsaasfqntthvlteaaiagkkdeligl
kenvilgrlipagtgsdfvrftqvvdqrtlkaie

Sequence, based on observed residues (ATOM records): (download)

>d1i6vd_ e.29.1.2 (D:) RNA-polymerase beta-prime {Thermus aquaticus [TaxId: 271]}
kevrkvrialaspekirswsygevekpeteakvcercavevtrsivrryrmahielatpa
ahiwfvkdvpskiatlldlsateleqvlyfnkyivldpkaavldavpvekrqlltdxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxidarmgaeaiqellkeldleklerelle
emkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdatsdlndlyrrlinrn
nrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgserplrsltdilsgkq
grfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkmeekafapnvk
aarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlvegqsiqlhpl
vceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakpsrdiilglyy
itqvrkekkgagmafatpeealaayergevalnapivvagretsvgrlkfvfanpdeall
avahglldlqdtvttrylgrrletspgrilfarivgeavgdekvaqeliqmdvpqeknsl
kdlvyqaflrlgmektarlldalkyygftlsttsgitigiddavipeekqryleeadrkl
rqieqayemgfltdrerydqviqlwtettekvtqavfnnfeenypfnplyvmaqsgargn
pqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshgarkggadtalrtads
gyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlrlrkrsdiesglygrvlar
evealgrrleegrylsledvhflikaaeagevrevpvrspltcqtrygvcqkcygydlsm
arpvsigeavgvvaaesigepgtqltmrtgtditqglprvielfearrpkakaviseidg
vvrieegedrlsvfvesegfskeyklpkdarllvkdgdyveagqpltrgaidphqlleak
gpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyvevtdpgdsrllegqvlekwd
vealnerliavpvawkpllmgvtksalstkswlsaasfqntthvlteaaiagkkdeligl
kenvilgrlipagtgsdfvrftqvvdqrtlkaie

SCOPe Domain Coordinates for d1i6vd_:

Click to download the PDB-style file with coordinates for d1i6vd_.
(The format of our PDB-style files is described here.)

Timeline for d1i6vd_: