PDB entry 1i6v

View 1i6v on RCSB PDB site
Description: thermus aquaticus core RNA polymerase-rifampicin complex
Class: transcription
Keywords: transferase, transcription, DNA-directed RNA polymerase, 3d- structure
Deposited on 2001-03-05, released 2001-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.276
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KWU8
      • conflict (111)
    Domains in SCOPe 2.07: d1i6va1, d1i6va2
  • Chain 'B':
    Compound: DNA-directed RNA polymerase
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KWU8
      • conflict (111)
      • conflict (231)
    Domains in SCOPe 2.07: d1i6vb1, d1i6vb2
  • Chain 'C':
    Compound: DNA-directed RNA polymerase
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KWU7
      • conflict (1)
      • conflict (1109)
    Domains in SCOPe 2.07: d1i6vc_
  • Chain 'D':
    Compound: DNA-directed RNA polymerase
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KWU6
      • conflict (69)
      • conflict (76)
      • conflict (90)
      • conflict (112)
      • conflict (138)
      • conflict (143)
      • conflict (602)
      • conflict (605)
      • conflict (748)
    Domains in SCOPe 2.07: d1i6vd_
  • Chain 'E':
    Compound: DNA-directed RNA polymerase
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1i6ve_
  • Heterogens: MG, ZN, RFP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i6vA (A:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevravdftpsadv
    eimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasslptpevsk
    gekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigerslee
    irqalakkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i6vA (A:)
    lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
    stipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevravdftpsadveimnp
    dlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtr
    lgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1i6vB (B:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevravdftpsadv
    eimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasslptpevsk
    gekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigerslee
    irqalakkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i6vB (B:)
    esklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvl
    hefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevravdftpsadvei
    mnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqve
    dtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeass
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1i6vC (C:)
    mkikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkg
    kgglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlpl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasg
    vvtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlft
    llrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermv
    mgspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvt
    eevvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvf
    slntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevvkvdgtriavryedgrlvhplrryarsnqgtafdqrprvrvgqrvkkgdlladgpas
    eegflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgper
    itrdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifgek
    ardvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdklan
    rhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqry
    ispvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspee
    qlkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqpl
    ggkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpepsv
    pesfrvlvkelqalaldvqtldekdnpvdvfeglaskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i6vC (C:)
    kikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkgk
    gglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlplm
    tedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasgv
    vtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlftl
    lrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkde
    vflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermvm
    gspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltre
    ragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvte
    evvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvfs
    lntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedg
    evvkvdgtriavryedgrlvhplrryarsnqgtafdqrprvrvgqrvkkgdlladgpase
    egflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgperi
    trdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifgeka
    rdvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdklanr
    hgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqryi
    spvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspeeq
    lkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqplg
    gkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpepsvp
    esfrvlvkelqalaldvqtldekdnpvdvfegl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1i6vD (D:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfeakvcercavevtrsivrryrmahielatpaahiwfvkdvpskiatlldlsa
    teleqvlyfnkyivldpkaavldavpvekrqlltdxxxxxxxxxxxxxxxxxxxxxxxxx
    xxxxxxxxxxxidarmgaeaiqellkeldleklerelleemkhpsrarrakarkrlevvr
    afldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlndlyrrlinrnnrlkkllaq
    gapeiiirnekrmlqeavdavidngrrgspvtnpgserplrsltdilsgkqgrfrqnllg
    krvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkmeekafapnvkaarrmlerq
    rdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlvegqsiqlhplvceafnadf
    dgdqmavhvplssfaqaeariqmlsahnllspasgeplakpsrdiilglyyitqvrkekk
    gagmafatpeealaayergevalnapivvagretsvgrlkfvfanpdeallavahglldl
    qdtvttrylgrrletspgrilfarivgeavgdekvaqeliqmdvpqeknslkdlvyqafl
    rlgmektarlldalkyygftlsttsgitigiddavipeekqryleeadrklrqieqayem
    gfltdrerydqviqlwtettekvtqavfnnfeenypfnplyvmaqsgargnpqqirqlcg
    mrglmqkpsgetfevpvrssfregltvleyfisshgarkggadtalrtadsgyltrklvd
    vaheivvreadcgttnyisvplfqmdevtrtlrlrkrsdiesglygrvlarevealgrrl
    eegrylsledvhflikaaeagevrevpvrspltcqtrygvcqkcygydlsmarpvsigea
    vgvvaaesigepgtqltmrtfhtggvavgtditqglprvielfearrpkakaviseidgv
    vrieegedrlsvfvesegfskeyklpkdarllvkdgdyveagqpltrgaidphqlleakg
    peaverylvdeiqkvyraqgvklhdkhieivvrqmlkyvevtdpgdsrllegqvlekwdv
    ealnerliaegkvpvawkpllmgvtksalstkswlsaasfqntthvlteaaiagkkdeli
    glkenvilgrlipagtgsdfvrftqvvdqrtlkaieearkeaveakekeaprrpvrreqp
    gkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i6vD (D:)
    kevrkvrialaspekirswsygevekpeteakvcercavevtrsivrryrmahielatpa
    ahiwfvkdvpskiatlldlsateleqvlyfnkyivldpkaavldavpvekrqlltdxxxx
    xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxidarmgaeaiqellkeldleklerelle
    emkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdatsdlndlyrrlinrn
    nrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgserplrsltdilsgkq
    grfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkmeekafapnvk
    aarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlvegqsiqlhpl
    vceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakpsrdiilglyy
    itqvrkekkgagmafatpeealaayergevalnapivvagretsvgrlkfvfanpdeall
    avahglldlqdtvttrylgrrletspgrilfarivgeavgdekvaqeliqmdvpqeknsl
    kdlvyqaflrlgmektarlldalkyygftlsttsgitigiddavipeekqryleeadrkl
    rqieqayemgfltdrerydqviqlwtettekvtqavfnnfeenypfnplyvmaqsgargn
    pqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshgarkggadtalrtads
    gyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlrlrkrsdiesglygrvlar
    evealgrrleegrylsledvhflikaaeagevrevpvrspltcqtrygvcqkcygydlsm
    arpvsigeavgvvaaesigepgtqltmrtgtditqglprvielfearrpkakaviseidg
    vvrieegedrlsvfvesegfskeyklpkdarllvkdgdyveagqpltrgaidphqlleak
    gpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyvevtdpgdsrllegqvlekwd
    vealnerliavpvawkpllmgvtksalstkswlsaasfqntthvlteaaiagkkdeligl
    kenvilgrlipagtgsdfvrftqvvdqrtlkaie
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1i6vE (E:)
    maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
    vtwamkelltgrlffgenlvpedrlqkemerlypteeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i6vE (E:)
    maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
    vtwamkelltgrlffgenlvpedrlqkemerlypteee