Lineage for d1i6hk_ (1i6h K:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506235Fold d.74: DCoH-like [55247] (4 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 506311Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 506337Family d.74.3.2: RPB11 [64311] (1 protein)
  6. 506338Protein RPB11 [64312] (1 species)
  7. 506339Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (4 PDB entries)
  8. 506343Domain d1i6hk_: 1i6h K: [61842]
    Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hi1, d1i6hi2, d1i6hj_, d1i6hl_

Details for d1i6hk_

PDB Entry: 1i6h (more details), 3.3 Å

PDB Description: rna polymerase ii elongation complex

SCOP Domain Sequences for d1i6hk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6hk_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae)}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOP Domain Coordinates for d1i6hk_:

Click to download the PDB-style file with coordinates for d1i6hk_.
(The format of our PDB-style files is described here.)

Timeline for d1i6hk_: