Lineage for d1i5lf_ (1i5l F:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948630Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 948631Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 948632Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 948633Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 948634Species Archaeoglobus fulgidus, AF-Sm1 [TaxId:2234] [63761] (2 PDB entries)
  8. 948668Domain d1i5lf_: 1i5l F: [61796]
    complexed with short poly-U RNA
    protein/RNA complex; complexed with uri

Details for d1i5lf_

PDB Entry: 1i5l (more details), 2.75 Å

PDB Description: crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus complexed with short poly-u rna
PDB Compounds: (F:) putative snrnp sm-like protein af-sm1

SCOPe Domain Sequences for d1i5lf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5lf_ b.38.1.1 (F:) Archaeal homoheptameric Sm protein {Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]}
prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi
rgdtvvfvspap

SCOPe Domain Coordinates for d1i5lf_:

Click to download the PDB-style file with coordinates for d1i5lf_.
(The format of our PDB-style files is described here.)

Timeline for d1i5lf_: