Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Tryparedoxin II [64062] (1 species) |
Species Crithidia fasciculata [TaxId:5656] [64063] (6 PDB entries) |
Domain d1i5ga_: 1i5g A: [61784] complexed with glutathionylspermidine complexed with trs, ts5 |
PDB Entry: 1i5g (more details), 1.4 Å
SCOPe Domain Sequences for d1i5ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} sglkkffpystnvlkgaaadialpslagktvffyfsaswcppsraftpqlidfykahaek knfevmliswdesaedfkdyyakmpwlalpfedrkgmeflttgfdvksiptlvgveadsg niittqartmvvkdpeakdfpwpn
Timeline for d1i5ga_: