Lineage for d1i5ga_ (1i5g A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877844Protein Tryparedoxin II [64062] (1 species)
  7. 2877845Species Crithidia fasciculata [TaxId:5656] [64063] (6 PDB entries)
  8. 2877846Domain d1i5ga_: 1i5g A: [61784]
    complexed with glutathionylspermidine
    complexed with trs, ts5

Details for d1i5ga_

PDB Entry: 1i5g (more details), 1.4 Å

PDB Description: tryparedoxin ii complexed with glutathionylspermidine
PDB Compounds: (A:) tryparedoxin II

SCOPe Domain Sequences for d1i5ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]}
sglkkffpystnvlkgaaadialpslagktvffyfsaswcppsraftpqlidfykahaek
knfevmliswdesaedfkdyyakmpwlalpfedrkgmeflttgfdvksiptlvgveadsg
niittqartmvvkdpeakdfpwpn

SCOPe Domain Coordinates for d1i5ga_:

Click to download the PDB-style file with coordinates for d1i5ga_.
(The format of our PDB-style files is described here.)

Timeline for d1i5ga_: