Lineage for d1i4yb_ (1i4y B:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765456Superfamily a.24.4: Hemerythrin-like [47188] (1 family) (S)
  5. 765457Family a.24.4.1: Hemerythrin-like [47189] (2 proteins)
    Iron-binding proteins
  6. 765458Protein Hemerythrin [47190] (2 species)
  7. 765459Species Phascolopsis gouldii [TaxId:6442] [47192] (3 PDB entries)
  8. 765461Domain d1i4yb_: 1i4y B: [61739]

Details for d1i4yb_

PDB Entry: 1i4y (more details), 1.8 Å

PDB Description: the crystal structure of phascolopsis gouldii wild type methemerythrin
PDB Compounds: (B:) methemerythrin

SCOP Domain Sequences for d1i4yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4yb_ a.24.4.1 (B:) Hemerythrin {Phascolopsis gouldii [TaxId: 6442]}
gfpipdpyvwdpsfrtfysiiddehktlfngifhlaiddnadnlgelrrctgkhflneqv
lmqasqyqfydehkkehetfihaldnwkgdvkwakswlvnhiktidfkykgki

SCOP Domain Coordinates for d1i4yb_:

Click to download the PDB-style file with coordinates for d1i4yb_.
(The format of our PDB-style files is described here.)

Timeline for d1i4yb_: