SCOP 1.61: Domain d1i4ra1: 1i4r A:1-120

Lineage for d1i4ra1 (1i4r A:1-120)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.40: OB-fold [50198] (8 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)

6. Protein Staphylococcal enterotoxin C2, SEC2 [50222] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50223] (7 PDB entries)

8. Domain d1i4ra1: 1i4r A:1-120 [61727]
   Other proteins in same PDB: d1i4ra2

Details for d1i4ra1

PDB Entry: 1i4r, 2.1 Å

PDB Description: crystal structure of staphylococcal enterotoxin c2 at 100k crystallized at ph 6.5

SCOP Domain Sequences for d1i4ra1:

Sequence, based on SEQRES records:

>d1i4ra1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnvgkvtggktcmyggitkheg

Sequence, based on observed residues (ATOM records):

>d1i4ra1 b.40.2.2 (A:1-120) Staphylococcal enterotoxin C2, SEC2 {Staphylococcus aureus}
esqpdptpdelhksseftgtmgnmkylyddhyvsatkvmsvdkflahdliynisdkklkn
ydkvktellnedlakkykdevvdvygsnyyvncyfsskdnggktcmyggitkheg

Timeline for d1i4ra1:

• d1i4ra1 first appeared in SCOP 1.57
  
• d1i4ra1 appears in SCOP 1.59
  
• d1i4ra1 appears in SCOP 1.63
  
• d1i4ra1 appears in the current release, SCOPe 2.08