SCOP 1.69: Domain d1i4dd_: 1i4d D:

Lineage for d1i4dd_ (1i4d D:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (43 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rac [52595] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52596] (12 PDB entries)

8. Domain d1i4dd_: 1i4d D: [61684]
   Other proteins in same PDB: d1i4da_, d1i4db_
   rac1 in complex with arfaptin

Details for d1i4dd_

PDB Entry: 1i4d, 2.5 Å

PDB Description: crystal structure analysis of rac1-gdp complexed with arfaptin (p21)

SCOP Domain Sequences for d1i4dd_:

Sequence; same for both SEQRES and ATOM records:

>d1i4dd_ c.37.1.8 (D:) Rac {Human (Homo sapiens)}
qaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagq
edydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd
dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc

Timeline for d1i4dd_:

• d1i4dd_ first appeared in SCOP 1.57
  
• d1i4dd_ appears in SCOP 1.67
  
• d1i4dd_ appears in SCOP 1.71
  
• d1i4dd_ appears in the current release, SCOPe 2.08