Lineage for d1i4dd_ (1i4d D:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69650Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 69802Protein Rac [52595] (1 species)
  7. 69803Species Human (Homo sapiens) [TaxId:9606] [52596] (10 PDB entries)
  8. 69810Domain d1i4dd_: 1i4d D: [61684]
    Other proteins in same PDB: d1i4da_, d1i4db_

Details for d1i4dd_

PDB Entry: 1i4d (more details), 2.5 Å

PDB Description: crystal structure analysis of rac1-gdp complexed with arfaptin (p21)

SCOP Domain Sequences for d1i4dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4dd_ c.37.1.8 (D:) Rac {Human (Homo sapiens)}
qaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagq
edydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlrd
dkdtieklkekkltpitypqglamakeigavkylecsaltqrglktvfdeairavlc

SCOP Domain Coordinates for d1i4dd_:

Click to download the PDB-style file with coordinates for d1i4dd_.
(The format of our PDB-style files is described here.)

Timeline for d1i4dd_: