SCOP 1.75: Domain d1i49a_: 1i49 A:

Lineage for d1i49a_ (1i49 A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (4 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.2: Arfaptin, Rac-binding fragment [64599] (1 protein)

6. Protein Arfaptin, Rac-binding fragment [64600] (1 species)
   active form is a dimer

7. Species Human (Homo sapiens) [TaxId:9606] [64601] (4 PDB entries)

8. Domain d1i49a_: 1i49 A: [61679]

Details for d1i49a_

PDB Entry: 1i49, 2.8 Å

PDB Description: crystal structure analysis of arfaptin

PDB Compounds: (A:) arfaptin 2

SCOP Domain Sequences for d1i49a_:

Sequence; same for both SEQRES and ATOM records:

>d1i49a_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
srtvdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspel
qeefgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleyday
rtdleelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkql
llfhnavsayfagnqkqleqt

Timeline for d1i49a_:

• d1i49a_ first appeared in SCOP 1.57
  
• d1i49a_ appears in SCOP 1.73
  
• d1i49a_ appears in SCOPe 2.01
  
• d1i49a_ appears in the current release, SCOPe 2.08