Lineage for d1i49a_ (1i49 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737998Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2737999Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) (S)
    core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends
  5. 2738028Family a.238.1.2: Arfaptin, Rac-binding fragment [64599] (2 proteins)
    automatically mapped to Pfam PF06456
  6. 2738029Protein Arfaptin, Rac-binding fragment [64600] (1 species)
    active form is a dimer
  7. 2738030Species Human (Homo sapiens) [TaxId:9606] [64601] (4 PDB entries)
  8. 2738037Domain d1i49a_: 1i49 A: [61679]

Details for d1i49a_

PDB Entry: 1i49 (more details), 2.8 Å

PDB Description: crystal structure analysis of arfaptin
PDB Compounds: (A:) arfaptin 2

SCOPe Domain Sequences for d1i49a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i49a_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]}
srtvdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspel
qeefgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleyday
rtdleelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkql
llfhnavsayfagnqkqleqt

SCOPe Domain Coordinates for d1i49a_:

Click to download the PDB-style file with coordinates for d1i49a_.
(The format of our PDB-style files is described here.)

Timeline for d1i49a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i49b_