Class a: All alpha proteins [46456] (290 folds) |
Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
Family a.238.1.2: Arfaptin, Rac-binding fragment [64599] (2 proteins) automatically mapped to Pfam PF06456 |
Protein Arfaptin, Rac-binding fragment [64600] (1 species) active form is a dimer |
Species Human (Homo sapiens) [TaxId:9606] [64601] (4 PDB entries) |
Domain d1i49a_: 1i49 A: [61679] |
PDB Entry: 1i49 (more details), 2.8 Å
SCOPe Domain Sequences for d1i49a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i49a_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} srtvdlelelqiellretkrkyesvlqlgraltahlysllqtqhalgdafadlsqkspel qeefgynaetqkllckngetllgavnffvssintlvtktmedtlmtvkqyeaarleyday rtdleelslgprdagtrgrlesaqatfqahrdkyeklrgdvaiklkfleenkikvmhkql llfhnavsayfagnqkqleqt
Timeline for d1i49a_: