Lineage for d1i48k_ (1i48 K:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399758Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 399759Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 400015Family c.67.1.3: Cystathionine synthase-like [53402] (13 proteins)
  6. 400063Protein Cystathionine gamma-synthase, CGS [53405] (2 species)
  7. 400064Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [53407] (4 PDB entries)
  8. 400095Domain d1i48k_: 1i48 K: [61677]

Details for d1i48k_

PDB Entry: 1i48 (more details), 3.25 Å

PDB Description: cystathionine gamma-synthase in complex with the inhibitor ctcpo

SCOP Domain Sequences for d1i48k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i48k_ c.67.1.3 (K:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum)}
yasflnsdgsvaihagerlgrgivtdaittpvvntsayffnktselidfkekrrasfeyg
rygnpttvvleekisalegaestllmasgmcastvmllalvpagghivtttdcyrktrif
ietilpkmgitatvidpadvgalelalnqkkvnlfftesptnpflrcvdielvsklchek
galvcidgtfatplnqkalalgadlvlhsatkflgghndvlagcisgplklvseirnlhh
ilggalnpnaayliirgmktlhlrvqqqnstalrmaeileahpkvrhvyypglqshpehh
iakkqmtgfggavsfevdgdllttakfvdalkipyiapsfggcesivdqpaimsywdlsq
sdrakygimdnlvrfsfgvedfddlkadilqaldsi

SCOP Domain Coordinates for d1i48k_:

Click to download the PDB-style file with coordinates for d1i48k_.
(The format of our PDB-style files is described here.)

Timeline for d1i48k_: