Lineage for d1i48k_ (1i48 K:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 73100Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
  4. 73101Superfamily c.67.1: PLP-dependent transferases [53383] (5 families) (S)
  5. 73298Family c.67.1.3: Cystathionine synthase-like [53402] (7 proteins)
  6. 73326Protein Cystathionine gamma-synthase, CGS [53405] (2 species)
  7. 73327Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [53407] (4 PDB entries)
  8. 73370Domain d1i48k_: 1i48 K: [61677]

Details for d1i48k_

PDB Entry: 1i48 (more details), 3.25 Å

PDB Description: cystathionine gamma-synthase in complex with the inhibitor ctcpo

SCOP Domain Sequences for d1i48k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i48k_ c.67.1.3 (K:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum)}
yasflnsdgsvaihagerlgrgivtdaittpvvntsayffnktselidfkekrrasfeyg
rygnpttvvleekisalegaestllmasgmcastvmllalvpagghivtttdcyrktrif
ietilpkmgitatvidpadvgalelalnqkkvnlfftesptnpflrcvdielvsklchek
galvcidgtfatplnqkalalgadlvlhsatkflgghndvlagcisgplklvseirnlhh
ilggalnpnaayliirgmktlhlrvqqqnstalrmaeileahpkvrhvyypglqshpehh
iakkqmtgfggavsfevdgdllttakfvdalkipyiapsfggcesivdqpaimsywdlsq
sdrakygimdnlvrfsfgvedfddlkadilqaldsi

SCOP Domain Coordinates for d1i48k_:

Click to download the PDB-style file with coordinates for d1i48k_.
(The format of our PDB-style files is described here.)

Timeline for d1i48k_: