Lineage for d1i2rb_ (1i2r B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 972170Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 972171Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 972646Protein Transaldolase [51588] (3 species)
    probably related to class I aldolases by a circular permutation
  7. 972647Species Escherichia coli [TaxId:562] [51589] (7 PDB entries)
  8. 972653Domain d1i2rb_: 1i2r B: [61581]
    mutant

Details for d1i2rb_

PDB Entry: 1i2r (more details), 2.1 Å

PDB Description: crystal structure of escherichia coli transaldolase b mutant s176a
PDB Compounds: (B:) transaldolase b

SCOPe Domain Sequences for d1i2rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i2rb_ c.1.10.1 (B:) Transaldolase {Escherichia coli [TaxId: 562]}
tdkltslrqyttvvadtgdiaamklyqpqdattnpslilnaaqipeyrkliddavawakq
qsndraqqivdatdklavnigleilklvpgristevdarlsydteasiakakrliklynd
agisndriliklastwqgiraaeqlekegincnltllfsfaqaracaeagvfliapfvgr
ildwykantdkkeyapaedpgvvsvseiyqyykehgyetvvmgasfrnigeilelagcdr
ltiapallkelaesegaierklsytgevkarpariteseflwqhnqdpmavdklaegirk
faidqeklekmigdll

SCOPe Domain Coordinates for d1i2rb_:

Click to download the PDB-style file with coordinates for d1i2rb_.
(The format of our PDB-style files is described here.)

Timeline for d1i2rb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1i2ra_