Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (8 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (12 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein Transaldolase [51588] (3 species) probably related to class I aldolases by a circular permutation |
Species Escherichia coli [TaxId:562] [51589] (7 PDB entries) |
Domain d1i2ra_: 1i2r A: [61580] |
PDB Entry: 1i2r (more details), 2.1 Å
SCOP Domain Sequences for d1i2ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i2ra_ c.1.10.1 (A:) Transaldolase {Escherichia coli [TaxId: 562]} tdkltslrqyttvvadtgdiaamklyqpqdattnpslilnaaqipeyrkliddavawakq qsndraqqivdatdklavnigleilklvpgristevdarlsydteasiakakrliklynd agisndriliklastwqgiraaeqlekegincnltllfsfaqaracaeagvfliapfvgr ildwykantdkkeyapaedpgvvsvseiyqyykehgyetvvmgasfrnigeilelagcdr ltiapallkelaesegaierklsytgevkarpariteseflwqhnqdpmavdklaegirk faidqeklekmigdll
Timeline for d1i2ra_: