| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
| Protein Interleukin-6 [47272] (2 species) |
| Species Human herpesvirus 8, Kaposi's sarcoma herpes-virus [TaxId:37296] [63528] (1 PDB entry) |
| Domain d1i1rb_: 1i1r B: [61548] Other proteins in same PDB: d1i1ra1, d1i1ra2, d1i1ra3 |
PDB Entry: 1i1r (more details), 2.4 Å
SCOPe Domain Sequences for d1i1rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i1rb_ a.26.1.1 (B:) Interleukin-6 {Human herpesvirus 8, Kaposi's sarcoma herpes-virus [TaxId: 37296]}
efekdlliqrlnwmlwvidecfrdlcyrtgickgilepaaifhlklpaindtdhcgligf
netsclkkladgffefevlfkflttefgksvinvdvmelltktlgwdiqeelnkltkthy
sppkfdrgllgrlqglkywvrhfasfyvlsamekfagqavrvldsip
Timeline for d1i1rb_: