Lineage for d1i1dc_ (1i1d C:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136612Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 136613Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) (S)
  5. 136614Family d.108.1.1: N-acetyl transferase, NAT [55730] (9 proteins)
  6. 136631Protein Glucosamine-phoshate N-acetyltransferase GNA1 [64351] (1 species)
  7. 136632Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64352] (3 PDB entries)
  8. 136639Domain d1i1dc_: 1i1d C: [61528]

Details for d1i1dc_

PDB Entry: 1i1d (more details), 1.8 Å

PDB Description: crystal structure of yeast gna1 bound to coa and glnac-6p

SCOP Domain Sequences for d1i1dc_:

Sequence, based on SEQRES records: (download)

>d1i1dc_ d.108.1.1 (C:) Glucosamine-phoshate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae)}
smslpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndnedkki
mqynpmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidql
vtigfdygcykiildcdeknvkfyekcgfsnagvemqirk

Sequence, based on observed residues (ATOM records): (download)

>d1i1dc_ d.108.1.1 (C:) Glucosamine-phoshate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae)}
smslpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwnkimqynp
mvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvtigf
dygcykiildcdeknvkfyekcgfsnagvemqirk

SCOP Domain Coordinates for d1i1dc_:

Click to download the PDB-style file with coordinates for d1i1dc_.
(The format of our PDB-style files is described here.)

Timeline for d1i1dc_: