Lineage for d1i12b_ (1i12 B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 136612Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
  4. 136613Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (2 families) (S)
  5. 136614Family d.108.1.1: N-acetyl transferase, NAT [55730] (9 proteins)
  6. 136631Protein Glucosamine-phoshate N-acetyltransferase GNA1 [64351] (1 species)
  7. 136632Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64352] (3 PDB entries)
  8. 136634Domain d1i12b_: 1i12 B: [61516]

Details for d1i12b_

PDB Entry: 1i12 (more details), 1.3 Å

PDB Description: crystal structure of saccharomyces cerevisiae gna1 complexed with accoa

SCOP Domain Sequences for d1i12b_:

Sequence, based on SEQRES records: (download)

>d1i12b_ d.108.1.1 (B:) Glucosamine-phoshate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae)}
slpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwndnedkkimq
ynpmvivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvt
igfdygcykiildcdeknvkfyekcgfsnagvemqirk

Sequence, based on observed residues (ATOM records): (download)

>d1i12b_ d.108.1.1 (B:) Glucosamine-phoshate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae)}
slpdgfyirrmeegdleqvtetlkvlttvgtitpesfcklikywneatvwnkkimqynpm
vivdkrtetvaatgniiierkiihelglcghiediavnskyqgqglgkllidqlvtigfd
ygcykiildcdeknvkfyekcgfsnagvemqirk

SCOP Domain Coordinates for d1i12b_:

Click to download the PDB-style file with coordinates for d1i12b_.
(The format of our PDB-style files is described here.)

Timeline for d1i12b_: