SCOP 1.75: Domain d1hzya_: 1hzy A:

Lineage for d1hzya_ (1hzy A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (2 proteins)

6. Protein Phosphotriesterase (parathion hydrolase, PTE) [51565] (3 species)

7. Species Pseudomonas diminuta [TaxId:293] [51566] (10 PDB entries)
   Uniprot P0A434 30-365

8. Domain d1hzya_: 1hzy A: [61468]

Details for d1hzya_

PDB Entry: 1hzy, 1.3 Å

PDB Description: high resolution structure of the zinc-containing phosphotriesterase from pseudomonas diminuta

PDB Compounds: (A:) phosphotriesterase

SCOP Domain Sequences for d1hzya_:

Sequence; same for both SEQRES and ATOM records:

>d1hzya_ c.1.9.3 (A:) Phosphotriesterase (parathion hydrolase, PTE) {Pseudomonas diminuta [TaxId: 293]}
drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
vrtivdvstfdigrdvsllaevsraadvhivaatglwfdpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtaasqrdgeqqaa
ifeseglspsrvcighsddtddlsyltalaargyligldhiphsaiglednasasallgi
rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdrvnpdgmafiplrvip
flrekgvpqetlagitvtnparflsptlras

Timeline for d1hzya_:

• d1hzya_ first appeared in SCOP 1.57
  
• d1hzya_ appears in SCOP 1.73
  
• d1hzya_ appears in SCOPe 2.01
  
• d1hzya_ appears in the current release, SCOPe 2.08