SCOP 1.59: Domain d1hzva1: 1hzv A:23-117

Lineage for d1hzva1 (1hzv A:23-117)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)

4. Superfamily a.3.1: Cytochrome c [46626] (7 families)

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [46674] (8 PDB entries)

8. Domain d1hzva1: 1hzv A:23-117 [61462]
   Other proteins in same PDB: d1hzva2

Details for d1hzva1

PDB Entry: 1hzv, 2.83 Å

PDB Description: domain swing upon his to ala mutation in nitrite reductase of pseudomonas aeruginosa

SCOP Domain Sequences for d1hzva1:

Sequence, based on SEQRES records:

>d1hzva1 a.3.1.2 (A:23-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
vrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltpditqqrgqqyleality
gtplgmpnwgssgelskeqitlmakyiqhtppqpp

Sequence, based on observed residues (ATOM records):

>d1hzva1 a.3.1.2 (A:23-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
vrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltpditqqrgqqyleality
gtplgmelskeqitlmakyiqhtppqpp

Timeline for d1hzva1:

• d1hzva1 first appeared in SCOP 1.57
  
• d1hzva1 appears in SCOP 1.61
  
• d1hzva1 appears in the current release, SCOPe 2.08