Lineage for d1hzjb_ (1hzj B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308075Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (33 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 308431Protein Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) [51752] (3 species)
  7. 308451Species Human (Homo sapiens) [TaxId:9606] [51754] (7 PDB entries)
  8. 308459Domain d1hzjb_: 1hzj B: [61451]
    complexed with cl, mg, nad, ud1

Details for d1hzjb_

PDB Entry: 1hzj (more details), 1.5 Å

PDB Description: human udp-galactose 4-epimerase: accommodation of udp-n-acetylglucosamine within the active site

SCOP Domain Sequences for d1hzjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzjb_ c.2.1.2 (B:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens)}
aekvlvtggagyigshtvlelleagylpvvidnfhnafrgggslpeslrrvqeltgrsve
feemdildqgalqrlfkkysfmavihfaglkavgesvqkpldyyrvnltgtiqlleimka
hgvknlvfsssatvygnpqylpldeahptggctnpygkskffieemirdlcqadktwnvv
llryfnptgahasgcigedpqgipnnlmpyvsqvaigrrealnvfgndydtedgtgvrdy
ihvvdlakghiaalrklkeqcgcriynlgtgtgysvlqmvqamekasgkkipykvvarre
gdvaacyanpslaqeelgwtaalgldrmcedlwrwqkqnpsgfgt

SCOP Domain Coordinates for d1hzjb_:

Click to download the PDB-style file with coordinates for d1hzjb_.
(The format of our PDB-style files is described here.)

Timeline for d1hzjb_: