| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.186: gpW/XkdW-like [64209] (2 superfamilies) alpha-beta(2)-alpha; antiparallel hairpin |
Superfamily d.186.1: Head-to-tail joining protein W, gpW [64210] (1 family) ![]() automatically mapped to Pfam PF02831 |
| Family d.186.1.1: Head-to-tail joining protein W, gpW [64211] (1 protein) |
| Protein Head-to-tail joining protein W, gpW [64212] (1 species) |
| Species Bacteriophage lambda [TaxId:10710] [64213] (1 PDB entry) |
| Domain d1hywa_: 1hyw A: [61425] |
PDB Entry: 1hyw (more details)
SCOPe Domain Sequences for d1hywa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hywa_ d.186.1.1 (A:) Head-to-tail joining protein W, gpW {Bacteriophage lambda [TaxId: 10710]}
mtrqeelaaaraalhdlmtgkrvatvqkdgrrveftatsvsdlkkyiaelevqtgmtq
Timeline for d1hywa_: