SCOPe 2.03: Domain d1hywa_: 1hyw A:

Lineage for d1hywa_ (1hyw A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.186: gpW/XkdW-like [64209] (2 superfamilies)
   alpha-beta(2)-alpha; antiparallel hairpin

4. Superfamily d.186.1: Head-to-tail joining protein W, gpW [64210] (1 family)
   automatically mapped to Pfam PF02831

5. Family d.186.1.1: Head-to-tail joining protein W, gpW [64211] (1 protein)

6. Protein Head-to-tail joining protein W, gpW [64212] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [64213] (1 PDB entry)

8. Domain d1hywa_: 1hyw A: [61425]

Details for d1hywa_

PDB Entry: 1hyw

PDB Description: solution structure of bacteriophage lambda gpw

PDB Compounds: (A:) head-to-tail joining protein w

SCOPe Domain Sequences for d1hywa_:

Sequence; same for both SEQRES and ATOM records:

>d1hywa_ d.186.1.1 (A:) Head-to-tail joining protein W, gpW {Bacteriophage lambda [TaxId: 10710]}
mtrqeelaaaraalhdlmtgkrvatvqkdgrrveftatsvsdlkkyiaelevqtgmtq

Timeline for d1hywa_:

• d1hywa_ first appeared in SCOP 1.57
  
• d1hywa_ appears in SCOPe 2.02
  
• d1hywa_ appears in SCOPe 2.04
  
• d1hywa_ appears in the current release, SCOPe 2.08