Lineage for d1hywa_ (1hyw A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 86231Fold d.186: Head-to-tail joining protein W, gpW [64209] (1 superfamily)
  4. 86232Superfamily d.186.1: Head-to-tail joining protein W, gpW [64210] (1 family) (S)
  5. 86233Family d.186.1.1: Head-to-tail joining protein W, gpW [64211] (1 protein)
  6. 86234Protein Head-to-tail joining protein W, gpW [64212] (1 species)
  7. 86235Species Bacteriophage lambda [TaxId:10710] [64213] (1 PDB entry)
  8. 86236Domain d1hywa_: 1hyw A: [61425]

Details for d1hywa_

PDB Entry: 1hyw (more details)

PDB Description: solution structure of bacteriophage lambda gpw

SCOP Domain Sequences for d1hywa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hywa_ d.186.1.1 (A:) Head-to-tail joining protein W, gpW {Bacteriophage lambda}
mtrqeelaaaraalhdlmtgkrvatvqkdgrrveftatsvsdlkkyiaelevqtgmtq

SCOP Domain Coordinates for d1hywa_:

Click to download the PDB-style file with coordinates for d1hywa_.
(The format of our PDB-style files is described here.)

Timeline for d1hywa_: