SCOPe 2.05: Domain d1hyqa_: 1hyq A:

Lineage for d1hyqa_ (1hyq A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Cell division regulator MinD [64019] (3 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [64020] (1 PDB entry)

8. Domain d1hyqa_: 1hyq A: [61412]

Details for d1hyqa_

PDB Entry: 1hyq, 2.6 Å

PDB Description: mind bacterial cell division regulator from a. fulgidus

PDB Compounds: (A:) cell division inhibitor (mind-1)

SCOPe Domain Sequences for d1hyqa_:

Sequence; same for both SEQRES and ATOM records:

>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeoglobus fulgidus [TaxId: 2234]}
vrtitvasgkggtgkttitanlgvalaqlghdvtivdaditmanlelilgmeglpvtlqn
vlagearideaiyvgpggvkvvpagvsleglrkanpekledvltqimestdillldapag
lersaviaiaaaqelllvvnpeissitdglktkivaerlgtkvlgvvvnrittlgiemak
neieaileakviglipedpevrraaaygkpvvlrspnspaaraivelanyia

Timeline for d1hyqa_:

• d1hyqa_ first appeared in SCOP 1.57
  
• d1hyqa_ appears in SCOPe 2.04
  
• d1hyqa_ appears in SCOPe 2.06
  
• d1hyqa_ appears in the current release, SCOPe 2.08