Lineage for d1hyqa_ (1hyq A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) 
Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins) 
Protein Cell division regulator MinD [64019] (3 species) 
Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [64020] (1 PDB entry) 
Domain d1hyqa_: 1hyq A: [61412]
Details for d1hyqa_
PDB Entry: 1hyq (more details), 2.6 Å
PDB Description: mind bacterial cell division regulator from a. fulgidus
SCOP Domain Sequences for d1hyqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus}
vrtitvasgkggtgkttitanlgvalaqlghdvtivdaditmanlelilgmeglpvtlqn
vlagearideaiyvgpggvkvvpagvsleglrkanpekledvltqimestdillldapag
lersaviaiaaaqelllvvnpeissitdglktkivaerlgtkvlgvvvnrittlgiemak
neieaileakviglipedpevrraaaygkpvvlrspnspaaraivelanyia
SCOP Domain Coordinates for d1hyqa_:
Click to download the PDB-style file with coordinates for d1hyqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hyqa_:
- d1hyqa_ is new in SCOP 1.57
- d1hyqa_ appears in SCOP 1.59
- d1hyqa_ appears in the current release, SCOPe 2.08
View in 3D