Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (2 families) |
Family d.113.1.2: Isopentenyl diphosphate isomerase [64369] (1 protein) |
Protein Isopentenyl diphosphate isomerase [64370] (1 species) |
Species Escherichia coli [TaxId:562] [64371] (6 PDB entries) |
Domain d1hx3a_: 1hx3 A: [61351] |
PDB Entry: 1hx3 (more details), 2.1 Å
SCOP Domain Sequences for d1hx3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hx3a_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli} ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt nsvaghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft
Timeline for d1hx3a_: