SCOP 1.67: Domain d1hx3a_: 1hx3 A:

Lineage for d1hx3a_ (1hx3 A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (4 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (2 proteins)

6. Protein Isopentenyl diphosphate isomerase [64370] (1 species)

7. Species Escherichia coli [TaxId:562] [64371] (8 PDB entries)

8. Domain d1hx3a_: 1hx3 A: [61351]

Details for d1hx3a_

PDB Entry: 1hx3, 2.1 Å

PDB Description: crystal structure of e.coli isopentenyl diphosphate:dimethylallyl diphosphate isomerase

SCOP Domain Sequences for d1hx3a_:

Sequence; same for both SEQRES and ATOM records:

>d1hx3a_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvaghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft

Timeline for d1hx3a_:

• d1hx3a_ first appeared in SCOP 1.57
  
• d1hx3a_ appears in SCOP 1.65
  
• d1hx3a_ appears in SCOP 1.69
  
• d1hx3a_ appears in the current release, SCOPe 2.08