Lineage for d1hx1a2 (1hx1 A:189-381)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124261Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 124262Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)
  6. 124310Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)
  7. 124311Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)
  8. 124335Domain d1hx1a2: 1hx1 A:189-381 [61349]
    Other proteins in same PDB: d1hx1b_

Details for d1hx1a2

PDB Entry: 1hx1 (more details), 1.9 Å

PDB Description: crystal structure of a bag domain in complex with the hsc70 atpase domain

SCOP Domain Sequences for d1hx1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hx1a2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

SCOP Domain Coordinates for d1hx1a2:

Click to download the PDB-style file with coordinates for d1hx1a2.
(The format of our PDB-style files is described here.)

Timeline for d1hx1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hx1a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1hx1b_