SCOP 1.61: Domain d1hx1a1: 1hx1 A:5-188

Lineage for d1hx1a1 (1hx1 A:5-188)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families)

5. Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)

6. Protein Heat shock protein 70kDa, ATPase fragment [53069] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53070] (25 PDB entries)

8. Domain d1hx1a1: 1hx1 A:5-188 [61348]
   Other proteins in same PDB: d1hx1b_

Details for d1hx1a1

PDB Entry: 1hx1, 1.9 Å

PDB Description: crystal structure of a bag domain in complex with the hsc70 atpase domain

SCOP Domain Sequences for d1hx1a1:

Sequence; same for both SEQRES and ATOM records:

>d1hx1a1 c.55.1.1 (A:5-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus)}
pavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnpt
ntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmvl
tkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiayg
ldkk

Timeline for d1hx1a1:

• d1hx1a1 first appeared in SCOP 1.57
  
• d1hx1a1 appears in SCOP 1.59
  
• d1hx1a1 appears in SCOP 1.63
  
• d1hx1a1 appears in the current release, SCOPe 2.08