Lineage for d1hw8d2 (1hw8 D:488-586,D:704-859)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684320Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
    unusual fold
  4. 1684321Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 1684322Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 1684323Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 1684324Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)
  8. 1684348Domain d1hw8d2: 1hw8 D:488-586,D:704-859 [61305]
    Other proteins in same PDB: d1hw8a1, d1hw8b1, d1hw8c1, d1hw8d1
    complexed with 114, adp

Details for d1hw8d2

PDB Entry: 1hw8 (more details), 2.1 Å

PDB Description: complex of the catalytic portion of human hmg-coa reductase with compactin (also known as mevastatin)
PDB Compounds: (D:) hmg-coa reductase

SCOPe Domain Sequences for d1hw8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hw8d2 d.179.1.1 (D:488-586,D:704-859) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
hergvsirrqllskklsepsslqylpyrdynyslvmgaccenvigympipvgvagplcld
ekefqvpmattegclvastnrgcraiglgggassrvladXksvvceavipakvvrevlkt
tteamievninknlvgsamagsiggynahaanivtaiyiacgqdaaqnvgssncitlmea
sgptnedlyisctmpsieigtvgggtnllpqqaclqmlgvqgackdnpgenarqlarivc
gtvmagelslmaalaa

SCOPe Domain Coordinates for d1hw8d2:

Click to download the PDB-style file with coordinates for d1hw8d2.
(The format of our PDB-style files is described here.)

Timeline for d1hw8d2: