Lineage for d1hv1a_ (1hv1 A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 165029Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 165041Protein Xylanase II [49979] (13 species)
  7. 165060Species Bacillus circulans [TaxId:1397] [49980] (9 PDB entries)
  8. 165067Domain d1hv1a_: 1hv1 A: [61286]

Details for d1hv1a_

PDB Entry: 1hv1 (more details), 1.8 Å

PDB Description: dissecting electrostatic interactions and the ph-dependent activity of a family 11 glycosidase

SCOP Domain Sequences for d1hv1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv1a_ b.29.1.11 (A:) Xylanase II {Bacillus circulans}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftaywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

SCOP Domain Coordinates for d1hv1a_:

Click to download the PDB-style file with coordinates for d1hv1a_.
(The format of our PDB-style files is described here.)

Timeline for d1hv1a_: