Lineage for d1hv0a_ (1hv0 A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) 
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) Protein Xylanase II [49979] (13 species) 
Species Bacillus circulans [TaxId:1397] [49980] (9 PDB entries) 
Domain d1hv0a_: 1hv0 A: [61285]
Details for d1hv0a_
PDB Entry: 1hv0 (more details), 1.6 Å
PDB Description: dissecting electrostatic interactions and the ph-dependent activity of a family 11 glycosidase
SCOP Domain Sequences for d1hv0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hv0a_ b.29.1.11 (A:) Xylanase II {Bacillus circulans}
astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyfvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw
SCOP Domain Coordinates for d1hv0a_:
Click to download the PDB-style file with coordinates for d1hv0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hv0a_:
- d1hv0a_ first appeared in SCOP 1.57
- d1hv0a_ appears in SCOP 1.59
- d1hv0a_ appears in SCOP 1.63
- d1hv0a_ appears in the current release, SCOPe 2.08
View in 3D