Lineage for d1huxa_ (1hux A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492306Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (5 proteins)
  6. 2492307Protein Hydroxyglutaryl-CoA dehydratase component A [64090] (1 species)
  7. 2492308Species Acidaminococcus fermentans [TaxId:905] [64091] (1 PDB entry)
  8. 2492309Domain d1huxa_: 1hux A: [61278]
    complexed with adp, sf4

Details for d1huxa_

PDB Entry: 1hux (more details), 3 Å

PDB Description: crystal structure of the acidaminococcus fermentans (r)-2-hydroxyglutaryl-coa dehydratase component a
PDB Compounds: (A:) activator of (r)-2-hydroxyglutaryl-coa dehydratase

SCOPe Domain Sequences for d1huxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]}
siytlgidvgstaskciilkdgkeivakslvavgtgtsgparsisevlenahmkkedmaf
tlatgygrnslegiadkqmselschamgasfiwpnvhtvidiggqdvkvihvengtmtnf
qmndkcaagtgrfldvmanilevkvsdlaelgakstkrvaisstctvfaesevisqlskg
tdkidiiagihrsvasrviglanrvgivkdvvmtggvaqnygvrgaleeglgveiktspl
aqyngalgaalyaykkaak

SCOPe Domain Coordinates for d1huxa_:

Click to download the PDB-style file with coordinates for d1huxa_.
(The format of our PDB-style files is described here.)

Timeline for d1huxa_: