Lineage for d1htzb_ (1htz B:)
- Root: SCOP 1.59
Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins) 
Protein beta-Lactamase, class A [56606] (12 species) 
Species Klebsiella pneumoniae, TEM52 [TaxId:573] [64473] (1 PDB entry) 
Domain d1htzb_: 1htz B: [61263]
Details for d1htzb_
PDB Entry: 1htz (more details), 2.4 Å
PDB Description: crystal structure of tem52 beta-lactamase
SCOP Domain Sequences for d1htzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1htzb_ e.3.1.1 (B:) beta-Lactamase, class A {Klebsiella pneumoniae, TEM52}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlvkyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgasergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw
SCOP Domain Coordinates for d1htzb_:
Click to download the PDB-style file with coordinates for d1htzb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1htzb_:
- d1htzb_ first appeared in SCOP 1.57
- d1htzb_ appears in SCOP 1.61
- d1htzb_ appears in the current release, SCOPe 2.08
View in 3D
