Lineage for d1htxa_ (1htx A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2634908Superfamily g.3.2: Plant inhibitors of proteinases and amylases [57027] (1 family) (S)
  5. 2634909Family g.3.2.1: Plant inhibitors of proteinases and amylases [57028] (4 proteins)
  6. 2634910Protein alpha-amylase inhibitor (AAI) [57036] (1 species)
  7. 2634911Species Prince's feather (Amaranthus hypochondriacus) [TaxId:28502] [57037] (3 PDB entries)
  8. 2634914Domain d1htxa_: 1htx A: [61261]

Details for d1htxa_

PDB Entry: 1htx (more details)

PDB Description: solution structure of the main alpha-amylase inhibitor from amaranth seeds
PDB Compounds: (A:) alpha-amylase inhibitor aai

SCOPe Domain Sequences for d1htxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1htxa_ g.3.2.1 (A:) alpha-amylase inhibitor (AAI) {Prince's feather (Amaranthus hypochondriacus) [TaxId: 28502]}
cipkwnrcgpkmdgvpccepytctsdyygncs

SCOPe Domain Coordinates for d1htxa_:

Click to download the PDB-style file with coordinates for d1htxa_.
(The format of our PDB-style files is described here.)

Timeline for d1htxa_: