SCOPe 2.01: Domain d1ht9a_: 1ht9 A:

Lineage for d1ht9a_ (1ht9 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.1: Calbindin D9K [47474] (1 protein)
   made of two EF-hands only

6. Protein Calbindin D9K [47475] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47476] (18 PDB entries)
   Uniprot P02633

8. Domain d1ht9a_: 1ht9 A: [61252]
   EF-hand swapped dimer
   complexed with ca

Details for d1ht9a_

PDB Entry: 1ht9, 1.76 Å

PDB Description: domain swapping ef-hands

PDB Compounds: (A:) calbindin d9k

SCOPe Domain Sequences for d1ht9a_:

Sequence; same for both SEQRES and ATOM records:

>d1ht9a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]}
mkspeelkgifekyaakegdpnnlskeelklllqtefpsllkgmstldelfeeldkngdg
evsfeefqvlvkkisq

Timeline for d1ht9a_:

• d1ht9a_ first appeared in SCOP 1.57
  
• d1ht9a_ appears in SCOP 1.75
  
• d1ht9a_ appears in SCOPe 2.02
  
• d1ht9a_ appears in the current release, SCOPe 2.08, called d1ht9a1