SCOPe 2.06: Domain d1hs6a3: 1hs6 A:209-460

Lineage for d1hs6a3 (1hs6 A:209-460)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
   adopts thermolysin-like fold

6. Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64340] (56 PDB entries)
   Uniprot P09960

8. Domain d1hs6a3: 1hs6 A:209-460 [61235]
   Other proteins in same PDB: d1hs6a1, d1hs6a2
   complexed with act, bes, imd, yb, zn

Details for d1hs6a3

PDB Entry: 1hs6, 1.95 Å

PDB Description: structure of leukotriene a4 hydrolase complexed with bestatin.

PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d1hs6a3:

Sequence; same for both SEQRES and ATOM records:

>d1hs6a3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

Timeline for d1hs6a3:

• d1hs6a3 first appeared in SCOP 1.57
  
• d1hs6a3 appears in SCOPe 2.05
  
• d1hs6a3 appears in SCOPe 2.07
  
• d1hs6a3 appears in the current release, SCOPe 2.08