Lineage for d1hs6a3 (1hs6 A:209-460)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 194566Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 194567Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 194846Family d.92.1.13: Leukotriene A4 hydrolase catalytic domain [64338] (1 protein)
  6. 194847Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)
  7. 194848Species Human (Homo sapiens) [TaxId:9606] [64340] (2 PDB entries)
  8. 194849Domain d1hs6a3: 1hs6 A:209-460 [61235]
    Other proteins in same PDB: d1hs6a1, d1hs6a2

Details for d1hs6a3

PDB Entry: 1hs6 (more details), 1.95 Å

PDB Description: structure of leukotriene a4 hydrolase complexed with bestatin.

SCOP Domain Sequences for d1hs6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hs6a3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens)}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

SCOP Domain Coordinates for d1hs6a3:

Click to download the PDB-style file with coordinates for d1hs6a3.
(The format of our PDB-style files is described here.)

Timeline for d1hs6a3: