SCOP 1.59: Domain d1hs6a1: 1hs6 A:461-610

Lineage for d1hs6a1 (1hs6 A:461-610)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (13 superfamilies)

4. Superfamily a.118.1: ARM repeat [48371] (9 families)

5. Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein)
   this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain

6. Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63610] (1 PDB entry)

8. Domain d1hs6a1: 1hs6 A:461-610 [61233]
   Other proteins in same PDB: d1hs6a2, d1hs6a3

Details for d1hs6a1

PDB Entry: 1hs6, 1.95 Å

PDB Description: structure of leukotriene a4 hydrolase complexed with bestatin.

SCOP Domain Sequences for d1hs6a1:

Sequence; same for both SEQRES and ATOM records:

>d1hs6a1 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens)}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd

Timeline for d1hs6a1:

• d1hs6a1 first appeared in SCOP 1.57
  
• d1hs6a1 appears in SCOP 1.61
  
• d1hs6a1 appears in the current release, SCOPe 2.08