Lineage for d1hr9c1 (1hr9 C:16-233)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049845Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1049846Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1049847Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1049996Protein Mitochondrial processing peptidase (MPP) alpha chain [64302] (1 species)
  7. 1049997Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64303] (4 PDB entries)
  8. 1050024Domain d1hr9c1: 1hr9 C:16-233 [61216]
    Other proteins in same PDB: d1hr9b1, d1hr9b2, d1hr9d1, d1hr9d2, d1hr9f1, d1hr9f2, d1hr9h1, d1hr9h2
    complexed with epe, zn; mutant

Details for d1hr9c1

PDB Entry: 1hr9 (more details), 3.01 Å

PDB Description: yeast mitochondrial processing peptidase beta-e73q mutant complexed with malate dehydrogenase signal peptide
PDB Compounds: (C:) mitochondrial processing peptidase alpha subunit

SCOPe Domain Sequences for d1hr9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr9c1 d.185.1.1 (C:16-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkstehv
egramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelqeq
klsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnkfy
tpentvaafvgvphekaleltgkylgdwqsthppitkk

SCOPe Domain Coordinates for d1hr9c1:

Click to download the PDB-style file with coordinates for d1hr9c1.
(The format of our PDB-style files is described here.)

Timeline for d1hr9c1: