Lineage for d1hr7e1 (1hr7 E:14-233)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139995Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
  4. 139996Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
  5. 139997Family d.185.1.1: MPP-like [63412] (4 proteins)
  6. 140038Protein Mitochondrial processing peptidase (MPP) alpha chain [64302] (1 species)
  7. 140039Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64303] (4 PDB entries)
  8. 140052Domain d1hr7e1: 1hr7 E:14-233 [61188]
    Other proteins in same PDB: d1hr7b1, d1hr7b2, d1hr7d1, d1hr7d2, d1hr7f1, d1hr7f2, d1hr7h1, d1hr7h2

Details for d1hr7e1

PDB Entry: 1hr7 (more details), 2.55 Å

PDB Description: yeast mitochondrial processing peptidase beta-e73q mutant

SCOP Domain Sequences for d1hr7e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr7e1 d.185.1.1 (E:14-233) Mitochondrial processing peptidase (MPP) alpha chain {Baker's yeast (Saccharomyces cerevisiae)}
artdnfklsslanglkvatsntpghfsalglyidagsrfegrnlkgcthildrlafkste
hvegramaetlellggnyqctssrenlmyqasvfnqdvgkmlqlmsetvrfpkiteqelq
eqklsaeyeidevwmkpelvlpellhtaaysgetlgsplicprglipsiskyylldyrnk
fytpentvaafvgvphekaleltgkylgdwqsthppitkk

SCOP Domain Coordinates for d1hr7e1:

Click to download the PDB-style file with coordinates for d1hr7e1.
(The format of our PDB-style files is described here.)

Timeline for d1hr7e1: