Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins) Pfam PF00491 |
Protein Arginase [52770] (5 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [52771] (34 PDB entries) Uniprot P07824 |
Domain d1hqgc_: 1hqg C: [61138] complexed with mn, orn, ure |
PDB Entry: 1hqg (more details), 2 Å
SCOPe Domain Sequences for d1hqgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqgc_ c.42.1.1 (C:) Arginase {Norway rat (Rattus norvegicus) [TaxId: 10116]} kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda htdintplttssgnlcgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg tkregnhkpetdyl
Timeline for d1hqgc_: